PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ote100208590071
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lamiaceae; Nepetoideae; Ocimeae; Ocimum
Family G2-like
Protein Properties Length: 339aa    MW: 38462.2 Da    PI: 6.6298
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ote100208590071genomeOteDB-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.6e-31181235155
                       G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                                   k+r+rWt++LH+rFv++v++LGG++kA Pk+il+lm+ +gLt+ hvkSHLQkYR 
  Ote100208590071|100208590071 181 KTRIRWTQDLHDRFVDCVNRLGGPDKARPKAILQLMDTEGLTIFHVKSHLQKYRN 235
                                   68****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.589178238IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.9E-28179235IPR009057Homeodomain-like
SuperFamilySSF466892.69E-16179235IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-23181235IPR006447Myb domain, plants
PfamPF002492.5E-8185234IPR001005SANT/Myb domain
PfamPF143796.8E-20265312IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 339 aa     Download sequence    Send to blast
MEGVQHPYGF PEFPQNPGAQ KLAAGWEGAL DQSGFVSWPI NTMIGRIGSL APPFYATEVS  60
MGLLHHNLPV NNNNSNNTFR FLEDSSSTDQ YIRHNSHSYE NDQLIMLSES EHLSLLRKNL  120
LGDLDDTNML SSYPPFNLNQ DHRVSQSASP SYCANMNQFR QQPMATPGNN PVSPNVVPSS  180
KTRIRWTQDL HDRFVDCVNR LGGPDKARPK AILQLMDTEG LTIFHVKSHL QKYRNVNHVP  240
ESFEGRSDKK TSSHNLAHID IETGMQMKEA LQLQLDVQRR LHEQLEIQRN LQLSIEEQGK  300
RLKMMLDQQR KTAQNLMEPT VSSSKPTVED PDFVMTSCV
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078839.11e-100PREDICTED: protein PHR1-LIKE 1-like isoform X2
TrEMBLA0A022RJM14e-90A0A022RJM1_ERYGU; Uncharacterized protein
STRINGPGSC0003DMT4000297581e-73(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24912458